CSGALNACT1 antibody (N-Term)

Catalog No. ABIN634697

Product Details anti-CSGALNACT1 Antibody

Target: CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSGALNACT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CSGALNACT1 antibody was raised against the N terminal Of Csgalnact1

Purification: Affinity purified

Immunogen: CSGALNACT1 antibody was raised using the N terminal Of Csgalnact1 corresponding to a region with amino acids KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CSGALNACT1 Blocking Peptide, catalog no. 33R-4236, is also available for use as a blocking control in assays to test for specificity of this CSGALNACT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSGALNACT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSGALNACT1

Target: CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))

Alternative Name: CSGALNACT1 (CSGALNACT1 Products)

Synonyms: CSGalNAcT-1 antibody, ChGn antibody, beta4GalNAcT antibody, CHGN antibody, 4732435N03Rik antibody, Chgn antibody, RGD1307618 antibody, chondroitin sulfate N-acetylgalactosaminyltransferase 1 antibody, CSGALNACT1 antibody, csgalnact1 antibody, Csgalnact1 antibody, LOC100517735 antibody

Background: CSGALNACT1 is a transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). It is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process