MPZL2 antibody (N-Term)
-
- Target See all MPZL2 Antibodies
- MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MPZL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MPZL2 antibody was raised against the N terminal of MPZL2
- Purification
- Affinity purified
- Immunogen
- MPZL2 antibody was raised using the N terminal of MPZL2 corresponding to a region with amino acids LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF
- Top Product
- Discover our top product MPZL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MPZL2 Blocking Peptide, catalog no. 33R-4881, is also available for use as a blocking control in assays to test for specificity of this MPZL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))
- Alternative Name
- MPZL2 (MPZL2 Products)
- Synonyms
- cb837 antibody, eva1 antibody, mpzl2 antibody, wu:fb07b02 antibody, EVA1 antibody, EVA antibody, Eva antibody, Eva1 antibody, myelin protein zero-like 2b antibody, myelin protein zero like 2 antibody, myelin protein zero-like 2 antibody, mpzl2b antibody, MPZL2 antibody, Mpzl2 antibody
- Background
- Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis.
- Molecular Weight
- 22 kDa (MW of target protein)
-