PCDHA3 antibody (N-Term)
-
- Target See all PCDHA3 Antibodies
- PCDHA3 (Protocadherin alpha 3 (PCDHA3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCDHA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCDHA3 antibody was raised against the N terminal of PCDHA3
- Purification
- Affinity purified
- Immunogen
- PCDHA3 antibody was raised using the N terminal of PCDHA3 corresponding to a region with amino acids LFSWREDPGAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQD
- Top Product
- Discover our top product PCDHA3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCDHA3 Blocking Peptide, catalog no. 33R-4950, is also available for use as a blocking control in assays to test for specificity of this PCDHA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCDHA3 (Protocadherin alpha 3 (PCDHA3))
- Alternative Name
- PCDHA3 (PCDHA3 Products)
- Synonyms
- PCDH-ALPHA3 antibody, mKIAA0345 antibody, PCDHA2 antibody, PCDHA3 antibody, PCDHA4 antibody, Pcdha3 antibody, protocadherin alpha 3 antibody, protocadherin alpha-3 antibody, PCDHA3 antibody, Pcdha3 antibody, pcdha3 antibody, LOC100713314 antibody
- Background
- PCDHA3 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
- Molecular Weight
- 99 kDa (MW of target protein)
-