Cadherin 4 antibody

Catalog No. ABIN634765

Product Details anti-Cadherin 4 Antibody

Target: Cadherin 4 (CDH4)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cadherin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CDH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSRGPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPMEVFSIDSMSGRM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDH4 Blocking Peptide, catalog no. 33R-2616, is also available for use as a blocking control in assays to test for specificity of this CDH4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cadherin 4

Target: Cadherin 4 (CDH4)

Alternative Name: CDH4 (CDH4 Products)

Synonyms: cad4 antibody, rcad antibody, R-cadherin antibody, cadherin-4 antibody, AW120700 antibody, R-Cadh antibody, Rcad antibody, Cdh4l antibody, zgc:136316 antibody, CAD4 antibody, RCAD antibody, cadherin 4 antibody, cadherin 4, type 1, R-cadherin (retinal) antibody, Cadherin-4 antibody, cdh4 antibody, Cdh4 antibody, CDH4 antibody, cdh-4 antibody

Background: CDH4 gene is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Based on studies in chicken and mouse, this cadherin is thought to play an important role during brain segmentation and neuronal outgrowth. In addition, a role in kidney and muscle development is indicated. Of particular interest are studies showing stable cis-heterodimers of cadherins 2 and 4 in cotransfected cell lines. Previously thought to interact in an exclusively homophilic manner, this is the first evidence of cadherin heterodimerization.

Molecular Weight: 82 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Regulation of Cell Size