APP antibody (Middle Region)
-
- Target See all APP Antibodies
- APP (Amyloid beta (A4) Precursor Protein (APP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- APP antibody was raised against the middle region of APP
- Purification
- Affinity purified
- Immunogen
- APP antibody was raised using the middle region of APP corresponding to a region with amino acids RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG
- Top Product
- Discover our top product APP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
APP Blocking Peptide, catalog no. 33R-8067, is also available for use as a blocking control in assays to test for specificity of this APP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APP (Amyloid beta (A4) Precursor Protein (APP))
- Alternative Name
- APP (APP Products)
- Synonyms
- AAA antibody, ABETA antibody, ABPP antibody, AD1 antibody, APPI antibody, CTFgamma antibody, CVAP antibody, PN-II antibody, PN2 antibody, aaa antibody, abeta antibody, abpp antibody, ad1 antibody, appi antibody, ctfgamma antibody, cvap antibody, pn2 antibody, APP antibody, APP-like antibody, APPL antibody, Abeta antibody, BcDNA:GH04413 antibody, CG7727 antibody, Dmel\\CG7727 antibody, EG:65F1.5 antibody, appl antibody, Abpp antibody, Adap antibody, Ag antibody, Cvap antibody, E030013M08Rik antibody, betaApp antibody, app antibody, wu:fj34d10 antibody, wu:fk65e12 antibody, zgc:85740 antibody, amyloid beta precursor protein antibody, amyloid beta (A4) precursor protein antibody, beta amyloid protein precursor-like antibody, amyloid beta (A4) precursor protein a antibody, amyloid beta precursor protein L homeolog antibody, APP antibody, app antibody, Appl antibody, App antibody, appa antibody, app.L antibody
- Background
- APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
- Molecular Weight
- 85 kDa (MW of target protein)
- Pathways
- Caspase Cascade in Apoptosis, EGFR Signaling Pathway, Transition Metal Ion Homeostasis, Skeletal Muscle Fiber Development, Toll-Like Receptors Cascades, Feeding Behaviour
-