Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

APP antibody (Middle Region)

APP Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634767
  • Target See all APP Antibodies
    APP (Amyloid beta (A4) Precursor Protein (APP))
    Binding Specificity
    • 30
    • 28
    • 24
    • 19
    • 18
    • 16
    • 11
    • 8
    • 8
    • 8
    • 7
    • 7
    • 6
    • 6
    • 6
    • 6
    • 6
    • 6
    • 5
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reactivity
    • 265
    • 121
    • 114
    • 13
    • 10
    • 10
    • 9
    • 9
    • 9
    • 8
    • 8
    • 5
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 227
    • 72
    • 5
    • 5
    • 1
    Rabbit
    Clonality
    • 247
    • 63
    Polyclonal
    Conjugate
    • 149
    • 29
    • 21
    • 21
    • 10
    • 9
    • 7
    • 7
    • 7
    • 7
    • 7
    • 7
    • 4
    • 4
    • 4
    • 4
    • 4
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    This APP antibody is un-conjugated
    Application
    • 203
    • 148
    • 88
    • 52
    • 52
    • 51
    • 41
    • 41
    • 30
    • 26
    • 16
    • 11
    • 7
    • 3
    • 2
    • 2
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    APP antibody was raised against the middle region of APP
    Purification
    Affinity purified
    Immunogen
    APP antibody was raised using the middle region of APP corresponding to a region with amino acids RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG
    Top Product
    Discover our top product APP Primary Antibody
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    APP Blocking Peptide, catalog no. 33R-8067, is also available for use as a blocking control in assays to test for specificity of this APP antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APP antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    APP (Amyloid beta (A4) Precursor Protein (APP))
    Alternative Name
    APP (APP Products)
    Synonyms
    AAA antibody, ABETA antibody, ABPP antibody, AD1 antibody, APPI antibody, CTFgamma antibody, CVAP antibody, PN-II antibody, PN2 antibody, aaa antibody, abeta antibody, abpp antibody, ad1 antibody, appi antibody, ctfgamma antibody, cvap antibody, pn2 antibody, APP antibody, APP-like antibody, APPL antibody, Abeta antibody, BcDNA:GH04413 antibody, CG7727 antibody, Dmel\\CG7727 antibody, EG:65F1.5 antibody, appl antibody, Abpp antibody, Adap antibody, Ag antibody, Cvap antibody, E030013M08Rik antibody, betaApp antibody, app antibody, wu:fj34d10 antibody, wu:fk65e12 antibody, zgc:85740 antibody, amyloid beta precursor protein antibody, amyloid beta (A4) precursor protein antibody, beta amyloid protein precursor-like antibody, amyloid beta (A4) precursor protein a antibody, amyloid beta precursor protein L homeolog antibody, APP antibody, app antibody, Appl antibody, App antibody, appa antibody, app.L antibody
    Background
    APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
    Molecular Weight
    85 kDa (MW of target protein)
    Pathways
    Caspase Cascade in Apoptosis, EGFR Signaling Pathway, Transition Metal Ion Homeostasis, Skeletal Muscle Fiber Development, Toll-Like Receptors Cascades, Feeding Behaviour
You are here:
Support