LONRF2 antibody (Middle Region)
-
- Target See all LONRF2 products
- LONRF2 (LON Peptidase N-terminal Domain and Ring Finger 2 (LONRF2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LONRF2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LONRF2 antibody was raised against the middle region of LONRF2
- Purification
- Affinity purified
- Immunogen
- LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LONRF2 Blocking Peptide, catalog no. 33R-2908, is also available for use as a blocking control in assays to test for specificity of this LONRF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LONRF2 (LON Peptidase N-terminal Domain and Ring Finger 2 (LONRF2))
- Alternative Name
- LONRF2 (LONRF2 Products)
- Synonyms
- RGD1562137 antibody, AI851349 antibody, 2900060P06Rik antibody, LONRF2 antibody, RNF192 antibody, LON peptidase N-terminal domain and ring finger 2 antibody, Lonrf2 antibody, LONRF2 antibody, lonrf2 antibody
- Background
- LONRF2 contains 1 Lon domain,1 RING-type zinc finger and 6 TPR repeats. The function of the LONRF2 protein remains unknown.
- Molecular Weight
- 84 kDa (MW of target protein)
-