Norrie Disease (Pseudoglioma) antibody

Catalog No. ABIN634783

This Rabbit Polyclonal antibody specifically detects Norrie Disease (Pseudoglioma) in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Norrie Disease (Pseudoglioma) antibody (ABIN634783)

Target: Norrie Disease (Pseudoglioma) (NDP)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Norrie Disease (Pseudoglioma) antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Norrie Disease (Pseudoglioma) Antibody

Purification: Affinity purified

Immunogen: NDP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDP Blocking Peptide, (ABIN937500), is also available for use as a blocking control in assays to test for specificity of this NDP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Norrie Disease (Pseudoglioma)

Target: Norrie Disease (Pseudoglioma) (NDP)

Alternative Name: NDP

Background: NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1).

Molecular Weight: 15 kDa (MW of target protein)

Pathways: Sensory Perception of Sound