Leptin antibody (Middle Region)

Catalog No. ABIN634796

Product Details anti-Leptin Antibody

Target: Leptin (LEP)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Leptin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Leptin antibody was raised against the middle region of LEP

Purification: Affinity purified

Immunogen: Leptin antibody was raised using the middle region of LEP corresponding to a region with amino acids LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Leptin Blocking Peptide, catalog no. 33R-5033, is also available for use as a blocking control in assays to test for specificity of this Leptin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Leptin

Target: Leptin (LEP)

Alternative Name: Leptin (LEP Products)

Synonyms: ob antibody, obese antibody, LEPD antibody, OB antibody, OBS antibody, leptin antibody, Lep antibody, LEP antibody, lep antibody

Background: LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process