Neuregulin 3 antibody (Middle Region)

Catalog No. ABIN634810

Product Details anti-Neuregulin 3 Antibody

Target: Neuregulin 3 (NRG3)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Neuregulin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NRG3 antibody was raised against the middle region of NRG3

Purification: Affinity purified

Immunogen: NRG3 antibody was raised using the middle region of NRG3 corresponding to a region with amino acids TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NRG3 Blocking Peptide, catalog no. 33R-9286, is also available for use as a blocking control in assays to test for specificity of this NRG3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Neuregulin 3

Target: Neuregulin 3 (NRG3)

Alternative Name: NRG3 (NRG3 Products)

Synonyms: NRG3 antibody, HRG3 antibody, pro-NRG3 antibody, ska antibody, RGD1559678 antibody, neuregulin 3 antibody, pro-neuregulin-3, membrane-bound isoform antibody, NRG3 antibody, nrg3 antibody, LOC100478170 antibody, Nrg3 antibody

Background: Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.

Molecular Weight: 75 kDa (MW of target protein)

Pathways: RTK Signaling