MCTP1 antibody (Middle Region)

Catalog No. ABIN634827

Product Details anti-MCTP1 Antibody

Target: MCTP1 (Multiple C2 Domains, Transmembrane 1 (MCTP1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCTP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MCTP1 antibody was raised against the middle region of MCTP1

Purification: Affinity purified

Immunogen: MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MCTP1 Blocking Peptide, catalog no. 33R-5550, is also available for use as a blocking control in assays to test for specificity of this MCTP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCTP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MCTP1

Target: MCTP1 (Multiple C2 Domains, Transmembrane 1 (MCTP1))

Alternative Name: MCTP1 (MCTP1 Products)

Synonyms: MGC157203 antibody, MGC108303 antibody, 2810465F10Rik antibody, Mctp1-ps1 antibody, RGD1305199 antibody, multiple C2 and transmembrane domain containing 1 antibody, multiple C2 domains, transmembrane 1 antibody, MCTP1 antibody, mctp1 antibody, Mctp1 antibody

Background: MCTP1 belongs to the MCTP family.It contains 3 C2 domains. MCTP1 is a multi-pass membrane protein. It binds calcium via the C2 domains in absence of phospholipids. The function of MCTP1 remains unknown.

Molecular Weight: 89 kDa (MW of target protein)