OR6C75 antibody (Middle Region)

Catalog No. ABIN634832

Product Details anti-OR6C75 Antibody

Target: OR6C75 (Olfactory Receptor, Family 6, Subfamily C, Member 75 (OR6C75))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OR6C75 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OR6 C75 antibody was raised against the middle region of OR6 75

Purification: Affinity purified

Immunogen: OR6 C75 antibody was raised using the middle region of OR6 75 corresponding to a region with amino acids SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OR6C75 Blocking Peptide, catalog no. 33R-8330, is also available for use as a blocking control in assays to test for specificity of this OR6C75 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OR6C75

Target: OR6C75 (Olfactory Receptor, Family 6, Subfamily C, Member 75 (OR6C75))

Alternative Name: OR6C75 (OR6C75 Products)

Synonyms: olfactory receptor, family 6, subfamily C, member 75 antibody, olfactory receptor family 6 subfamily C member 75 antibody, OR6C75 antibody

Background: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Molecular Weight: 35 kDa (MW of target protein)