ATP2A1/SERCA1 antibody (N-Term)

Catalog No. ABIN634834

This Rabbit Polyclonal antibody specifically detects ATP2A1/SERCA1 in WB. It exhibits reactivity toward Human.

Quick Overview for ATP2A1/SERCA1 antibody (N-Term) (ABIN634834)

Target: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP2A1/SERCA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATP2A1/SERCA1 Antibody

Binding Specificity: N-Term

Specificity: ATP2 A1 antibody was raised against the N terminal of ATP2 1

Purification: Affinity purified

Immunogen: ATP2 A1 antibody was raised using the N terminal of ATP2 1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP2A1 Blocking Peptide, (ABIN5612217), is also available for use as a blocking control in assays to test for specificity of this ATP2A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP2A1/SERCA1

Target: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Alternative Name: ATP2A1

Background: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells.

Molecular Weight: 109 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process