ATP2A1/SERCA1 antibody (N-Term)
-
- Target See all ATP2A1/SERCA1 (ATP2A1) Antibodies
- ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP2A1/SERCA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP2 A1 antibody was raised against the N terminal of ATP2 1
- Purification
- Affinity purified
- Immunogen
- ATP2 A1 antibody was raised using the N terminal of ATP2 1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW
- Top Product
- Discover our top product ATP2A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP2A1 Blocking Peptide, catalog no. 33R-5884, is also available for use as a blocking control in assays to test for specificity of this ATP2A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
- Alternative Name
- ATP2A1 (ATP2A1 Products)
- Background
- This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells.
- Molecular Weight
- 109 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-