MDM1 antibody (N-Term)

Catalog No. ABIN634846

Product Details anti-MDM1 Antibody

Target: MDM1 (Mdm1 Nuclear Protein (MDM1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MDM1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MDM1 antibody was raised against the N terminal of MDM1

Purification: Affinity purified

Immunogen: MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MDM1 Blocking Peptide, catalog no. 33R-3420, is also available for use as a blocking control in assays to test for specificity of this MDM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MDM1

Target: MDM1 (Mdm1 Nuclear Protein (MDM1))

Alternative Name: MDM1 (MDM1 Products)

Synonyms: si:ch211-266a5.6 antibody, Arrd2 antibody, Mdm-1 antibody, Mdm1 nuclear protein antibody, Mdm1 nuclear protein homolog (mouse) antibody, transformed mouse 3T3 cell double minute 1 antibody, MDM1 antibody, Mdm1 antibody, mdm1 antibody

Background: MDM1 is a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53.

Molecular Weight: 25 kDa (MW of target protein)