PDE3A antibody (N-Term)

Catalog No. ABIN634852

This Rabbit Polyclonal antibody specifically detects PDE3A in WB. It exhibits reactivity toward Human.

Quick Overview for PDE3A antibody (N-Term) (ABIN634852)

Target: PDE3A (phosphodiesterase 3A, cGMP-Inhibited (PDE3A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDE3A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDE3A Antibody

Binding Specificity: N-Term

Specificity: PDE3 A antibody was raised against the N terminal of PDE3

Purification: Affinity purified

Immunogen: PDE3 A antibody was raised using the N terminal of PDE3 corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDE3A Blocking Peptide, (ABIN940501), is also available for use as a blocking control in assays to test for specificity of this PDE3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDE3A

Target: PDE3A (phosphodiesterase 3A, cGMP-Inhibited (PDE3A))

Alternative Name: PDE3A

Background: PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).

Molecular Weight: 125 kDa (MW of target protein)

Pathways: cAMP Metabolic Process