Myoferlin antibody
-
- Target See all Myoferlin (MYOF) Antibodies
- Myoferlin (MYOF)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Myoferlin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- FER1 L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
- Top Product
- Discover our top product MYOF Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FER1L3 Blocking Peptide, catalog no. 33R-7747, is also available for use as a blocking control in assays to test for specificity of this FER1L3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FER0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Myoferlin (MYOF)
- Alternative Name
- FER1L3 (MYOF Products)
- Synonyms
- FER1L3 antibody, 2310004N10Rik antibody, 2310051D19Rik antibody, E030042N20Rik antibody, Fer1l3 antibody, RGD1564216 antibody, zgc:63504 antibody, fer1l3 antibody, myoferlin antibody, MYOF antibody, Myof antibody, myof antibody, LOC100380767 antibody
- Background
- Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair.
- Molecular Weight
- 235 kDa (MW of target protein)
-