Myoferlin antibody

Catalog No. ABIN634863

Product Details anti-Myoferlin Antibody

Target: Myoferlin (MYOF)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Myoferlin antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FER1 L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FER1L3 Blocking Peptide, catalog no. 33R-7747, is also available for use as a blocking control in assays to test for specificity of this FER1L3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FER0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Myoferlin

Target: Myoferlin (MYOF)

Alternative Name: FER1L3 (MYOF Products)

Synonyms: FER1L3 antibody, 2310004N10Rik antibody, 2310051D19Rik antibody, E030042N20Rik antibody, Fer1l3 antibody, RGD1564216 antibody, zgc:63504 antibody, fer1l3 antibody, myoferlin antibody, MYOF antibody, Myof antibody, myof antibody, LOC100380767 antibody

Background: Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair.

Molecular Weight: 235 kDa (MW of target protein)