SYNGR2 antibody (N-Term)

Catalog No. ABIN634895

Product Details anti-SYNGR2 Antibody

Target: SYNGR2 (Synaptogyrin 2 (SYNGR2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SYNGR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Synaptogyrin 2 antibody was raised against the N terminal of SYNGR2

Purification: Affinity purified

Immunogen: Synaptogyrin 2 antibody was raised using the N terminal of SYNGR2 corresponding to a region with amino acids ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Synaptogyrin 2 Blocking Peptide, catalog no. 33R-2727, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNGR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SYNGR2

Target: SYNGR2 (Synaptogyrin 2 (SYNGR2))

Alternative Name: Synaptogyrin 2 (SYNGR2 Products)

Synonyms: Clast2 antibody, cellugyrin antibody, syngr2 antibody, MGC89604 antibody, Cellugyrin antibody, synaptogyrin 2 antibody, synaptogyrin 2 S homeolog antibody, SYNGR2 antibody, Syngr2 antibody, syngr2.S antibody, syngr2 antibody

Background: SYNGR2 is an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells.

Molecular Weight: 25 kDa (MW of target protein)