ZDHHC19 antibody (N-Term)
-
- Target See all ZDHHC19 products
- ZDHHC19 (Zinc Finger, DHHC-Type Containing 19 (ZDHHC19))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZDHHC19 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZDHHC19 antibody was raised against the N terminal of ZDHHC19
- Purification
- Affinity purified
- Immunogen
- ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZDHHC19 Blocking Peptide, catalog no. 33R-9177, is also available for use as a blocking control in assays to test for specificity of this ZDHHC19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC19 (Zinc Finger, DHHC-Type Containing 19 (ZDHHC19))
- Alternative Name
- ZDHHC19 (ZDHHC19 Products)
- Synonyms
- RGD1560310 antibody, Gm1744 antibody, Gm616 antibody, DHHC19 antibody, zinc finger, DHHC-type containing 19 antibody, zinc finger DHHC-type containing 19 antibody, zinc finger, DHHC domain containing 19 antibody, Zdhhc19 antibody, ZDHHC19 antibody
- Background
- ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.
- Molecular Weight
- 34 kDa (MW of target protein)
-