ZDHHC16 antibody (N-Term)
-
- Target See all ZDHHC16 Antibodies
- ZDHHC16 (Zinc Finger, DHHC-Type Containing 16 (ZDHHC16))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZDHHC16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZDHHC16 antibody was raised against the N terminal of ZDHHC16
- Purification
- Affinity purified
- Immunogen
- ZDHHC16 antibody was raised using the N terminal of ZDHHC16 corresponding to a region with amino acids SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC
- Top Product
- Discover our top product ZDHHC16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZDHHC16 Blocking Peptide, catalog no. 33R-8922, is also available for use as a blocking control in assays to test for specificity of this ZDHHC16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC16 (Zinc Finger, DHHC-Type Containing 16 (ZDHHC16))
- Alternative Name
- ZDHHC16 (ZDHHC16 Products)
- Synonyms
- APH2 antibody, MGC132171 antibody, 1500015N03Rik antibody, Aph2 antibody, zdhhc16 antibody, zgc:66369 antibody, zgc:63934 antibody, zinc finger DHHC-type containing 16 antibody, zinc finger, DHHC-type containing 16 S homeolog antibody, zinc finger, DHHC-type containing 16 antibody, zinc finger, DHHC domain containing 16 antibody, zinc finger, DHHC-type containing 16a antibody, zinc finger, DHHC-type containing 16b antibody, ZDHHC16 antibody, zdhhc16.S antibody, Zdhhc16 antibody, zdhhc16 antibody, zdhhc16a antibody, zdhhc16b antibody
- Background
- ZDHHC16 may be involved in apoptosis regulation.
- Molecular Weight
- 44 kDa (MW of target protein)
-