OMG antibody (Middle Region)

Catalog No. ABIN634958

Product Details anti-OMG Antibody

Target: OMG (Oligodendrocyte Myelin Glycoprotein (OMG))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OMG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OMG antibody was raised against the middle region of OMG

Purification: Affinity purified

Immunogen: OMG antibody was raised using the middle region of OMG corresponding to a region with amino acids NTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OMG Blocking Peptide, catalog no. 33R-6901, is also available for use as a blocking control in assays to test for specificity of this OMG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OMG

Target: OMG (Oligodendrocyte Myelin Glycoprotein (OMG))

Alternative Name: OMG (OMG Products)

Synonyms: OMGP antibody, omgp antibody, MGC107958 antibody, OMG antibody, DKFZp459F1351 antibody, oligodendrocyte myelin glycoprotein antibody, myelin oligodendrocyte glycoprotein antibody, oligodendrocyte-myelin glycoprotein antibody, OMG antibody, MOG antibody, Omg antibody, omg antibody

Background: OMG is a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway, Regulation of Cell Size