SLC25A38 antibody (Middle Region)

Catalog No. ABIN635042

Product Details anti-SLC25A38 Antibody

Target: SLC25A38 (Solute Carrier Family 25, Member 38 (SLC25A38))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A38 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SLC25 A38 antibody was raised against the middle region of SLC25 38

Purification: Affinity purified

Immunogen: SLC25 A38 antibody was raised using the middle region of SLC25 38 corresponding to a region with amino acids VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A38 Blocking Peptide, catalog no. 33R-9563, is also available for use as a blocking control in assays to test for specificity of this SLC25A38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A38

Target: SLC25A38 (Solute Carrier Family 25, Member 38 (SLC25A38))

Alternative Name: SLC25A38 (SLC25A38 Products)

Synonyms: AV019094 antibody, BC010801 antibody, RGD1311914 antibody, zgc:153036 antibody, solute carrier family 25 member 38 antibody, solute carrier family 25, member 38 antibody, solute carrier family 25 member 38 L homeolog antibody, solute carrier family 25, member 38a antibody, SLC25A38 antibody, Slc25a38 antibody, slc25a38.L antibody, slc25a38a antibody

Background: SLC25A38 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.

Molecular Weight: 33 kDa (MW of target protein)