WNT7B antibody (Middle Region)

Catalog No. ABIN635046

Product Details anti-WNT7B Antibody

Target: WNT7B (Wingless-Type MMTV Integration Site Family, Member 7B (WNT7B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNT7B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WNT7 B antibody was raised against the middle region of WNT7

Purification: Affinity purified

Immunogen: WNT7 B antibody was raised using the middle region of WNT7 corresponding to a region with amino acids WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WNT7B Blocking Peptide, catalog no. 33R-10029, is also available for use as a blocking control in assays to test for specificity of this WNT7B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WNT7B

Target: WNT7B (Wingless-Type MMTV Integration Site Family, Member 7B (WNT7B))

Alternative Name: WNT7B (WNT7B Products)

Synonyms: WNT7B antibody, Zwnt[c] antibody, si:ch211-239e6.2 antibody, wnt7 antibody, wnt7b antibody, wnt[c] antibody, Xwnt-7B antibody, Xwnt7B antibody, wnt-7b antibody, Wnt-7b antibody, xwnt7b antibody, protein Wnt-7b antibody, wingless-type MMTV integration site family, member 7Ba antibody, Wnt family member 7B antibody, wingless-type MMTV integration site family, member 7B antibody, Wnt family member 7B L homeolog antibody, LOC525135 antibody, wnt7ba antibody, WNT7B antibody, wnt7b antibody, Wnt7b antibody, wnt7b.L antibody

Background: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: WNT Signaling