CPT1B antibody (Carnitine Palmitoyltransferase 1B (Muscle))

Catalog No. ABIN635060

Product Details anti-CPT1B Antibody

Target: CPT1B

See all CPT1B Antibodies

Reactivity: Human

See all available reactivities across CPT1B antibodies

• Human 79
• Mouse 22
• Rat 17
• Dog 2
• Guinea Pig 2
• Horse 2
• Rabbit 2
• Cow 1
• Monkey 1
• Pig 1
• Sheep 1
• Zebrafish (Danio rerio) 1

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPT1B antibody is un-conjugated

See all available conjugates across CPT1B antibodies

• Un-conjugated 28
• HRP 9
• Biotin 8
• FITC 8
• APC 6
• Alkaline Phosphatase (AP) 6
• PE 6
• Alexa Fluor 350 1
• Alexa Fluor 488 1
• Alexa Fluor 555 1
• Alexa Fluor 594 1
• Alexa Fluor 647 1
• Alexa Fluor 680 1
• Alexa Fluor 750 1
• Cy3 1
• Cy5 1
• Cy5.5 1
• Cy7 1

Application: Western Blotting (WB)

See all available applications across CPT1B antibodies

• ELISA 58
• Western Blotting (WB) 58
• Immunohistochemistry (IHC) 30
• Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13
• Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 7
• Enzyme Immunoassay (EIA) 2
• Immunocytochemistry (ICC) 2
• Immunofluorescence (IF) 1
• Immunofluorescence (fixed cells) (IF/ICC) 1

Purification: Affinity purified

Immunogen: CPT1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPT1B Blocking Peptide, catalog no. 33R-2040, is also available for use as a blocking control in assays to test for specificity of this CPT1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPT1B

Target: CPT1B

Alternative Name: CPT1B (CPT1B Antibody Abstract)

Synonyms: CPT1-M, CPT1M, CPTI, CPTI-M, M-CPT1, MCCPT1, MCPT1, CPT-IB, M-CPTI, CPT1, CPTIB, cpt1al, zgc:103709, CPT1B, MGC147544, Cpt1, Cpt1-m, Cpti, Cpti-m, M-cpti, carnitine palmitoyltransferase 1B, carnitine palmitoyltransferase 1B (muscle), carnitine palmitoyltransferase 1B L homeolog, carnitine palmitoyltransferase 1b, muscle, CPT1B, Cpt1b, cpt1b, cpt1b.L

Background: The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: AMPK Signaling, Monocarboxylic Acid Catabolic Process