CPT1B antibody

Catalog No. ABIN635060

Product Details anti-CPT1B Antibody

Target: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPT1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CPT1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPT1B Blocking Peptide, catalog no. 33R-2040, is also available for use as a blocking control in assays to test for specificity of this CPT1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPT1B

Target: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Alternative Name: CPT1B (CPT1B Products)

Background: The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: AMPK Signaling, Monocarboxylic Acid Catabolic Process