CPT1B antibody
-
- Target See all CPT1B Antibodies
- CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CPT1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CPT1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
- Top Product
- Discover our top product CPT1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CPT1B Blocking Peptide, catalog no. 33R-2040, is also available for use as a blocking control in assays to test for specificity of this CPT1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))
- Alternative Name
- CPT1B (CPT1B Products)
- Synonyms
- CPT1-M antibody, CPT1M antibody, CPTI antibody, CPTI-M antibody, M-CPT1 antibody, MCCPT1 antibody, MCPT1 antibody, CPT-IB antibody, M-CPTI antibody, CPT1 antibody, CPTIB antibody, cpt1al antibody, zgc:103709 antibody, CPT1B antibody, MGC147544 antibody, Cpt1 antibody, Cpt1-m antibody, Cpti antibody, Cpti-m antibody, M-cpti antibody, carnitine palmitoyltransferase 1B antibody, carnitine palmitoyltransferase 1B (muscle) antibody, carnitine palmitoyltransferase 1B L homeolog antibody, carnitine palmitoyltransferase 1b, muscle antibody, CPT1B antibody, Cpt1b antibody, cpt1b antibody, cpt1b.L antibody
- Background
- The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria.
- Molecular Weight
- 88 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Monocarboxylic Acid Catabolic Process
-