CPT1B antibody (Carnitine Palmitoyltransferase 1B (Muscle))

Details for Product anti-CPT1B Antibody No. ABIN635060
Antigen
Reactivity
Human
102
28
20
2
2
2
2
1
1
1
1
1
Host
Rabbit
99
7
1
Clonality
Polyclonal
Conjugate
This CPT1B antibody is un-conjugated
9
9
9
7
7
7
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
81
73
36
13
13
3
2
2
1
1
Options
Immunogen CPT1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
Purification Affinity purified
Antigen
Alternative Name CPT1B (CPT1B Antibody Abstract)
Background The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria.
Molecular Weight 88 kDa (MW of target protein)
Pathways AMPK Signaling, Monocarboxylic Acid Catabolic Process
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CPT1B Blocking Peptide, catalog no. 33R-2040, is also available for use as a blocking control in assays to test for specificity of this CPT1B antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B) antibody (ABIN635060) CPT1B antibody used at 1 ug/ml to detect target protein.