PEMT antibody (C-Term)

Catalog No. ABIN635064

This anti-PEMT antibody is a Rabbit Polyclonal antibody detecting PEMT in WB. Suitable for Human.

Quick Overview for PEMT antibody (C-Term) (ABIN635064)

Target: PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEMT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PEMT Antibody

Binding Specificity: C-Term

Specificity: PEMT antibody was raised against the C terminal of PEMT

Purification: Affinity purified

Immunogen: PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEMT Blocking Peptide, (ABIN939050), is also available for use as a blocking control in assays to test for specificity of this PEMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEMT

Target: PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))

Alternative Name: PEMT

Background: PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17.

Molecular Weight: 26 kDa (MW of target protein)