SLC25A4 antibody
-
- Target See all SLC25A4 Antibodies
- SLC25A4 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC25 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
- Top Product
- Discover our top product SLC25A4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A4 Blocking Peptide, catalog no. 33R-5186, is also available for use as a blocking control in assays to test for specificity of this SLC25A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A4 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4))
- Alternative Name
- SLC25A4 (SLC25A4 Products)
- Synonyms
- 1 antibody, AAC1 antibody, ANT antibody, ANT 1 antibody, ANT1 antibody, PEO2 antibody, PEO3 antibody, T1 antibody, AU019225 antibody, Ant1 antibody, ant antibody, ant1 antibody, peo2 antibody, peo3 antibody, MANT1 antibody, SLC25A5 antibody, fa22e07 antibody, wu:fa22e07 antibody, zgc:77591 antibody, slc25a4 antibody, solute carrier family 25 member 4 antibody, solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 4 antibody, adenine nucleotide translocator antibody, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 antibody, solute carrier family 25 member 4 L homeolog antibody, SLC25A4 antibody, Slc25a4 antibody, slc25a4 antibody, ANT1 antibody, slc25a4.L antibody
- Background
- This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- Proton Transport, Dicarboxylic Acid Transport
-