CPT1A antibody

Catalog No. ABIN635089

Product Details anti-CPT1A Antibody

Target: CPT1A (Carnitine Palmitoyltransferase 1A (Liver) (CPT1A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPT1A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CPT1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPT1A Blocking Peptide, catalog no. 33R-5461, is also available for use as a blocking control in assays to test for specificity of this CPT1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPT1A

Target: CPT1A (Carnitine Palmitoyltransferase 1A (Liver) (CPT1A))

Alternative Name: CPT1A (CPT1A Products)

Background: The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.

Molecular Weight: 86 kDa (MW of target protein)

Pathways: AMPK Signaling, Regulation of Lipid Metabolism by PPARalpha, Feeding Behaviour, Monocarboxylic Acid Catabolic Process