NNT antibody (N-Term)

Catalog No. ABIN635092

This Rabbit Polyclonal antibody specifically detects NNT in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for NNT antibody (N-Term) (ABIN635092)

Target: NNT (Nicotinamide Nucleotide Transhydrogenase (NNT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NNT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NNT Antibody

Binding Specificity: N-Term

Specificity: NNT antibody was raised against the N terminal of NNT

Purification: Affinity purified

Immunogen: NNT antibody was raised using the N terminal of NNT corresponding to a region with amino acids IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NNT Blocking Peptide, (ABIN939592), is also available for use as a blocking control in assays to test for specificity of this NNT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NNT

Target: NNT (Nicotinamide Nucleotide Transhydrogenase (NNT))

Alternative Name: NNT

Background: NNT is an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification.

Molecular Weight: 114 kDa (MW of target protein)

Pathways: Proton Transport