IL22 Receptor alpha 1 antibody (Middle Region)

Catalog No. ABIN635102

Product Details anti-IL22 Receptor alpha 1 Antibody

Target: IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL22 Receptor alpha 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL22 R alpha 1 antibody was raised against the middle region of IL22 A1

Purification: Affinity purified

Immunogen: IL22 R alpha 1 antibody was raised using the middle region of IL22 A1 corresponding to a region with amino acids DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL22R alpha 1 Blocking Peptide, catalog no. 33R-2131, is also available for use as a blocking control in assays to test for specificity of this IL22R alpha 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL22 Receptor alpha 1

Target: IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))

Alternative Name: IL22R alpha 1 (IL22RA1 Products)

Synonyms: IL22RA1 antibody, CRF2-9 antibody, IL22R antibody, IL22R1 antibody, 9130219A07Rik antibody, ENSMUSG00000073746 antibody, IL-22R antibody, Il22r antibody, RGD1559655 antibody, interleukin 22 receptor subunit alpha 1 antibody, interleukin 22 receptor, alpha 1 antibody, IL22RA1 antibody, Il22ra1 antibody

Background: IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shared by the receptor complex for interleukin 10 (IL10). This gene and interleukin 28 receptor, alpha (IL28RA) form a cytokine receptor gene cluster in the chromosomal region 1p36.

Molecular Weight: 63 kDa (MW of target protein)