TMEM75 antibody (C-Term)

Catalog No. ABIN635165

Product Details anti-TMEM75 Antibody

Target: TMEM75 (Transmembrane Protein 75 (TMEM75))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM75 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM75 antibody was raised against the C terminal of TMEM75

Purification: Affinity purified

Immunogen: TMEM75 antibody was raised using the C terminal of TMEM75 corresponding to a region with amino acids VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM75 Blocking Peptide, catalog no. 33R-9846, is also available for use as a blocking control in assays to test for specificity of this TMEM75 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM75

Target: TMEM75 (Transmembrane Protein 75 (TMEM75))

Alternative Name: TMEM75 (TMEM75 Products)

Synonyms: transmembrane protein 75 antibody, TMEM75 antibody

Background: The function of TMEM75 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 15 kDa (MW of target protein)