PTPRR antibody (N-Term)
-
- Target See all PTPRR Antibodies
- PTPRR (Protein tyrosine Phosphatase, Receptor Type, R (PTPRR))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTPRR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PTPRR antibody was raised against the N terminal of PTPRR
- Purification
- Affinity purified
- Immunogen
- PTPRR antibody was raised using the N terminal of PTPRR corresponding to a region with amino acids NIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIP
- Top Product
- Discover our top product PTPRR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTPRR Blocking Peptide, catalog no. 33R-6718, is also available for use as a blocking control in assays to test for specificity of this PTPRR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTPRR (Protein tyrosine Phosphatase, Receptor Type, R (PTPRR))
- Alternative Name
- PTPRR (PTPRR Products)
- Synonyms
- EC-PTP antibody, PCPTP1 antibody, PTP-SL antibody, PTPBR7 antibody, PTPRQ antibody, Pcptp1 antibody, ec-ptp antibody, pcptp1 antibody, ptp-sl antibody, ptpbr7 antibody, PTPRR antibody, Gmcp1 antibody, RPTPRR antibody, mPTP213 antibody, protein tyrosine phosphatase, receptor type R antibody, protein tyrosine phosphatase, receptor type, R antibody, protein tyrosine phosphatase, receptor type R L homeolog antibody, protein tyrosine phosphatase, receptor type, r antibody, receptor-type tyrosine-protein phosphatase R antibody, PTPRR antibody, Ptprr antibody, ptprr.L antibody, ptprr antibody, LOC100715069 antibody
- Background
- PTPRR is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP.
- Molecular Weight
- 46 kDa (MW of target protein)
-