TRAF3IP3 antibody (Middle Region)

Catalog No. ABIN635207

Product Details anti-TRAF3IP3 Antibody

Target: TRAF3IP3 (TRAF3 Interacting Protein 3 (TRAF3IP3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRAF3IP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRAF3 IP3 antibody was raised against the middle region of TRAF3 P3

Purification: Affinity purified

Immunogen: TRAF3 IP3 antibody was raised using the middle region of TRAF3 P3 corresponding to a region with amino acids KQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRAF3IP3 Blocking Peptide, catalog no. 33R-4606, is also available for use as a blocking control in assays to test for specificity of this TRAF3IP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAF0 P3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRAF3IP3

Target: TRAF3IP3 (TRAF3 Interacting Protein 3 (TRAF3IP3))

Alternative Name: TRAF3IP3 (TRAF3IP3 Products)

Synonyms: DJ434O14.3 antibody, T3JAM antibody, 6030423D04Rik antibody, AI115021 antibody, T3jam antibody, RGD1304848 antibody, TRAF3 interacting protein 3 antibody, TRAF3IP3 antibody, Traf3ip3 antibody

Background: TRAF3IP3 stimulated cell growth by modulating the c-Jun N-terminal kinase (JNK) pathway. TRAF3 interacts with Smac/DIABLO via TRAF domain, leading to an increased proapoptotic effect of Smac/DIABLO in cytoplasm.

Molecular Weight: 61 kDa (MW of target protein)