Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) antibody
-
- Target See all Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) Antibodies
- Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5)
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- SLC17 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
- Top Product
- Discover our top product SLC17A5 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC17A5 Blocking Peptide, catalog no. 33R-4951, is also available for use as a blocking control in assays to test for specificity of this SLC17A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5)
- Alternative Name
- SLC17A5 (SLC17A5 Products)
- Synonyms
- AST antibody, ISSD antibody, NSD antibody, SD antibody, SIALIN antibody, SIASD antibody, SLD antibody, sialin antibody, got2 antibody, zgc:66329 antibody, 4631416G20Rik antibody, 4732491M05 antibody, SP55 antibody, sb:cb809 antibody, zgc:153077 antibody, solute carrier family 17 member 5 antibody, solute carrier family 17 member 5 S homeolog antibody, glutamic-oxaloacetic transaminase 2a, mitochondrial antibody, solute carrier family 17 (anion/sugar transporter), member 5 antibody, solute carrier family 17 (acidic sugar transporter), member 5 antibody, SLC17A5 antibody, slc17a5.S antibody, got2a antibody, Slc17a5 antibody, slc17a5 antibody
- Background
- SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.
- Molecular Weight
- 55 kDa (MW of target protein)
-