Dysferlin antibody
-
- Target See all Dysferlin (DYSF) Antibodies
- Dysferlin (DYSF)
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Dysferlin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids IVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFEL
- Top Product
- Discover our top product DYSF Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DYSF Blocking Peptide, catalog no. 33R-4205, is also available for use as a blocking control in assays to test for specificity of this DYSF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYSF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Dysferlin (DYSF)
- Alternative Name
- DYSF (DYSF Products)
- Synonyms
- DYSF antibody, fb73b05 antibody, wu:fb73b05 antibody, si:rp71-50c18.1 antibody, DKFZp459E1226 antibody, 2310004N10Rik antibody, AI604795 antibody, D6Pas3 antibody, mFLJ00175 antibody, FER1L1 antibody, LGMD2B antibody, MMD1 antibody, dysferlin antibody, dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) antibody, myoferlin antibody, DYSF antibody, dysf antibody, LOC589501 antibody, Dysf antibody
- Background
- DYSF belongs to the ferlin family and is a skeletal muscle protein found associated with the sarcolemma. It is involved in muscle contraction and contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. In addition, DYSF binds caveolin-3, a skeletal muscle membrane protein which is important in the formation of caveolae. Specific mutations in this gene have been shown to cause autosomal recessive limb girdle muscular dystrophy type 2B (LGMD2B) as well as Miyoshi myopathy.
- Molecular Weight
- 237 kDa (MW of target protein)
-