SGCE antibody (N-Term)

Catalog No. ABIN635274

Product Details anti-SGCE Antibody

Target: SGCE (Sarcoglycan, epsilon (SGCE))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SGCE antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SGCE antibody was raised against the N terminal of SGCE

Purification: Affinity purified

Immunogen: SGCE antibody was raised using the N terminal of SGCE corresponding to a region with amino acids TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SGCE Blocking Peptide, catalog no. 33R-9378, is also available for use as a blocking control in assays to test for specificity of this SGCE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGCE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SGCE

Target: SGCE (Sarcoglycan, epsilon (SGCE))

Alternative Name: SGCE (SGCE Products)

Synonyms: scge antibody, zgc:92318 antibody, DYT11 antibody, ESG antibody, e-SG antibody, sarcoglycan, epsilon antibody, sarcoglycan epsilon S homeolog antibody, sarcoglycan epsilon antibody, sgce antibody, sgce.S antibody, SGCE antibody, Sgce antibody

Background: SGCE is a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix.

Molecular Weight: 52 kDa (MW of target protein)