IFNGR2 antibody
-
- Target See all IFNGR2 Antibodies
- IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IFNGR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL
- Top Product
- Discover our top product IFNGR2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IFN Gamma R2 Blocking Peptide, catalog no. 33R-9941, is also available for use as a blocking control in assays to test for specificity of this IFN Gamma R2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNGR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))
- Alternative Name
- IFN gamma R2 (IFNGR2 Products)
- Synonyms
- Ifgr2 antibody, Ifgt antibody, AF-1 antibody, IFGR2 antibody, IFNGT1 antibody, interferon gamma receptor 2 antibody, Ifngr2 antibody, IFNGR2 antibody, LOC487739 antibody
- Background
- IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection.
- Molecular Weight
- 35 kDa (MW of target protein)
-