MUC15 antibody (Middle Region)

Catalog No. ABIN635309

The Rabbit Polyclonal anti-MUC15 antibody has been validated for WB. It is suitable to detect MUC15 in samples from Human.

Quick Overview for MUC15 antibody (Middle Region) (ABIN635309)

Target: MUC15 (Mucin 15, Cell Surface Associated (MUC15))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MUC15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MUC15 Antibody

Binding Specificity: Middle Region

Specificity: MUC15 antibody was raised against the middle region of MUC15

Purification: Affinity purified

Immunogen: MUC15 antibody was raised using the middle region of MUC15 corresponding to a region with amino acids KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MUC15 Blocking Peptide, (ABIN939767), is also available for use as a blocking control in assays to test for specificity of this MUC15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MUC15

Target: MUC15 (Mucin 15, Cell Surface Associated (MUC15))

Alternative Name: MUC15

Background: MUC15 may play a role in the cell adhesion to the extracellular matrix.

Molecular Weight: 36 kDa (MW of target protein)