ABCB1 antibody

Catalog No. ABIN635318

Product Details anti-ABCB1 Antibody

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCB1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ABCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCB1 Blocking Peptide, catalog no. 33R-1285, is also available for use as a blocking control in assays to test for specificity of this ABCB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCB1

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Alternative Name: ABCB1 (ABCB1 Products)

Synonyms: ABC20 antibody, CD243 antibody, CLCS antibody, GP170 antibody, MDR1 antibody, P-GP antibody, PGY1 antibody, Abcb1 antibody, Mdr1a antibody, p-gp antibody, xemdr antibody, Mdr1 antibody, Mdr1b antibody, Pgy-1 antibody, Pgy1 antibody, mdr antibody, ABCB1 antibody, PGP1 antibody, ATP binding cassette subfamily B member 1 antibody, ATP binding cassette subfamily B member 1A antibody, ATP binding cassette subfamily B member 1 L homeolog antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 1B antibody, ABCB1 antibody, Abcb1a antibody, abcb1.L antibody, Abcb1b antibody, Abcb1 antibody

Background: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Molecular Weight: 141 kDa (MW of target protein)