SLC5A9 antibody
-
- Target See all SLC5A9 Antibodies
- SLC5A9 (Solute Carrier Family 5 (Sodium/glucose Cotransporter), Member 9 (SLC5A9))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC5A9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC5 A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA
- Top Product
- Discover our top product SLC5A9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC5A9 Blocking Peptide, catalog no. 33R-6447, is also available for use as a blocking control in assays to test for specificity of this SLC5A9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC5A9 (Solute Carrier Family 5 (Sodium/glucose Cotransporter), Member 9 (SLC5A9))
- Alternative Name
- SLC5A9 (SLC5A9 Products)
- Synonyms
- SLC5A9 antibody, SGLT4 antibody, AI159731 antibody, solute carrier family 5 member 9 antibody, solute carrier family 5 (sodium/sugar cotransporter), member 9 antibody, solute carrier family 5 (sodium/glucose cotransporter), member 9 antibody, Slc5a9 antibody, SLC5A9 antibody, slc5a9 antibody
- Background
- SLC5A9 is involved in sodium-dependent transport of D-mannose, D-glucose and D-fructose.
- Molecular Weight
- 76 kDa (MW of target protein)
-