SLC27A6 antibody
-
- Target See all SLC27A6 Antibodies
- SLC27A6 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC27A6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC27 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL
- Top Product
- Discover our top product SLC27A6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC27A6 Blocking Peptide, catalog no. 33R-4665, is also available for use as a blocking control in assays to test for specificity of this SLC27A6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC27A6 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6))
- Alternative Name
- SLC27A6 (SLC27A6 Products)
- Synonyms
- zgc:153783 antibody, ACSVL2 antibody, FACVL2 antibody, FATP6 antibody, VLCS-H1 antibody, 4732438L20Rik antibody, solute carrier family 27 member 6 antibody, solute carrier family 27 (fatty acid transporter), member 6 antibody, solute carrier family 27 member 6 L homeolog antibody, SLC27A6 antibody, slc27a6 antibody, slc27a6.L antibody, Slc27a6 antibody
- Background
- SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
- Molecular Weight
- 70 kDa (MW of target protein)
-