KLRC3 antibody (N-Term)
-
- Target See all KLRC3 Antibodies
- KLRC3 (Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KLRC3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KLRC3 antibody was raised against the N terminal of KLRC3
- Purification
- Affinity purified
- Immunogen
- KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL
- Top Product
- Discover our top product KLRC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLRC3 Blocking Peptide, catalog no. 33R-6452, is also available for use as a blocking control in assays to test for specificity of this KLRC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLRC3 (Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3))
- Alternative Name
- KLRC3 (KLRC3 Products)
- Synonyms
- Klrc2 antibody, Nkg2e antibody, KLRC2 antibody, NKG2-C antibody, NKG2-E antibody, NKG2E antibody, killer cell lectin-like receptor subfamily C, member 3 antibody, killer cell lectin like receptor C3 antibody, Klrc3 antibody, KLRC3 antibody
- Background
- Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity.
- Molecular Weight
- 27 kDa (MW of target protein)
-