Ribophorin II antibody (Middle Region)

Catalog No. ABIN635418

Product Details anti-Ribophorin II Antibody

Target: Ribophorin II (RPN2)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ribophorin II antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Ribophorin II antibody was raised against the middle region of RPN2

Purification: Affinity purified

Immunogen: Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ribophorin II Blocking Peptide, catalog no. 33R-4018, is also available for use as a blocking control in assays to test for specificity of this Ribophorin II antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ribophorin II

Target: Ribophorin II (RPN2)

Alternative Name: Ribophorin II (RPN2 Products)

Synonyms: RIBIIR antibody, RPN-II antibody, RPNII antibody, SWP1 antibody, RPN2 antibody, 1300012C06Rik antibody, AV261018 antibody, Rpn-2 antibody, fb95d11 antibody, fj62b10 antibody, wu:fb61f08 antibody, wu:fb74e07 antibody, wu:fb95d11 antibody, wu:fj41f11 antibody, wu:fj62b10 antibody, rpn2 antibody, ribophorin II antibody, dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 antibody, ribophorin II S homeolog antibody, RPN2 antibody, Rpn2 antibody, rpn2 antibody, LOC5579328 antibody, Bm1_30625 antibody, rpn2.S antibody

Background: RPN2 is a type I integral membrane protein found only in the rough endoplasmic reticulum.

Molecular Weight: 67 kDa (MW of target protein)