TMEM161A antibody (Middle Region)

Catalog No. ABIN635452

Product Details anti-TMEM161A Antibody

Target: TMEM161A (Transmembrane Protein 161A (TMEM161A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM161A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM161 A antibody was raised against the middle region of TMEM161

Purification: Affinity purified

Immunogen: TMEM161 A antibody was raised using the middle region of TMEM161 corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM161A Blocking Peptide, catalog no. 33R-5117, is also available for use as a blocking control in assays to test for specificity of this TMEM161A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM160 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM161A

Target: TMEM161A (Transmembrane Protein 161A (TMEM161A))

Alternative Name: TMEM161A (TMEM161A Products)

Synonyms: AROS-29 antibody, AI428876 antibody, BB161850 antibody, BC021367 antibody, RGD1307703 antibody, transmembrane protein 161A antibody, transmembrane protein 161A L homeolog antibody, TMEM161A antibody, Tmem161a antibody, tmem161a.L antibody

Background: TMEM161A may be involved in the development of dendritic cells.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus