FAM62B antibody

Catalog No. ABIN635474

Product Details anti-FAM62B Antibody

Target: FAM62B (ESYT2) (Extended Synaptotagmin 2 (ESYT2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM62B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FAM62 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM62B Blocking Peptide, catalog no. 33R-6875, is also available for use as a blocking control in assays to test for specificity of this FAM62B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM62B

Target: FAM62B (ESYT2) (Extended Synaptotagmin 2 (ESYT2))

Alternative Name: FAM62B (ESYT2 Products)

Synonyms: CHR2SYT antibody, E-Syt2 antibody, FAM62B antibody, 2410017M09Rik antibody, 4921504I16Rik antibody, D12Ertd551e antibody, Fam62b antibody, extended synaptotagmin 2 antibody, extended synaptotagmin-like protein 2 antibody, ESYT2 antibody, Esyt2 antibody

Background: FAM62B may play a role as calcium-regulated intrinsic membrane protein.

Molecular Weight: 99 kDa (MW of target protein)