PRRG3 antibody (N-Term)

Catalog No. ABIN635480

Product Details anti-PRRG3 Antibody

Target: PRRG3 (Proline Rich Gla (G-Carboxyglutamic Acid) 3 (Transmembrane) (PRRG3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRRG3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRRG3 antibody was raised against the N terminal of PRRG3

Purification: Affinity purified

Immunogen: PRRG3 antibody was raised using the N terminal of PRRG3 corresponding to a region with amino acids EEICSYEEVKEVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMYVVVPLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRRG3 Blocking Peptide, catalog no. 33R-2360, is also available for use as a blocking control in assays to test for specificity of this PRRG3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRRG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRRG3

Target: PRRG3 (Proline Rich Gla (G-Carboxyglutamic Acid) 3 (Transmembrane) (PRRG3))

Alternative Name: PRRG3 (PRRG3 Products)

Synonyms: MGC84023 antibody, PRGP3 antibody, TMG3 antibody, Gm368 antibody, RGD1560309 antibody, proline rich and Gla domain 3 antibody, proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane) L homeolog antibody, proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane) antibody, PRRG3 antibody, prrg3.L antibody, Prrg3 antibody

Background: The function of PRRG3 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 26 kDa (MW of target protein)