TMEM132B antibody (Middle Region)

Catalog No. ABIN635495

Product Details anti-TMEM132B Antibody

Target: TMEM132B (Transmembrane Protein 132B (TMEM132B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM132B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM132 B antibody was raised against the middle region of TMEM132

Purification: Affinity purified

Immunogen: TMEM132 B antibody was raised using the middle region of TMEM132 corresponding to a region with amino acids VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM132B Blocking Peptide, catalog no. 33R-9746, is also available for use as a blocking control in assays to test for specificity of this TMEM132B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM132B

Target: TMEM132B (Transmembrane Protein 132B (TMEM132B))

Alternative Name: TMEM132B (TMEM132B Products)

Synonyms: RGD1566191 antibody, AK220418 antibody, mKIAA1786 antibody, transmembrane protein 132B antibody, Tmem132b antibody, TMEM132B antibody, tmem132b antibody, LOC100556911 antibody, LOC100606383 antibody

Background: TMEM132B single-pass type I membrane protein. It belongs to the TMEM132 family. The exact function of TMEM132B is not known.

Molecular Weight: 119 kDa (MW of target protein)