LOC729185 (N-Term) antibody
-
- Target
- LOC729185
- Binding Specificity
- N-Term
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Specificity
- LOC729185 antibody was raised against the N terminal Of Loc729185
- Purification
- Affinity purified
- Immunogen
- LOC729185 antibody was raised using the N terminal Of Loc729185 corresponding to a region with amino acids VSGDRRVRSRHAKVGTLGDREAILQRLDHLEEVVYNQLNGLAKPIGLVEG
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LOC729185 Blocking Peptide, catalog no. 33R-9806, is also available for use as a blocking control in assays to test for specificity of this LOC729185 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC729185 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LOC729185
- Background
- The exact function of LOC729185 is not known.
- Molecular Weight
- 41 kDa (MW of target protein)
-