MGC4172 (C-Term) antibody

Catalog No. ABIN635565

Product Details

Target: MGC4172

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: MGC4172 antibody was raised against the C terminal of MGC4172

Purification: Affinity purified

Immunogen: MGC4172 antibody was raised using the C terminal of MGC4172 corresponding to a region with amino acids VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC4172 Blocking Peptide, catalog no. 33R-9515, is also available for use as a blocking control in assays to test for specificity of this MGC4172 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC4172 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: MGC4172

Background: MGC4172 possesses oxidoreductase activity.

Molecular Weight: 19 kDa (MW of target protein)