PCDH15 antibody (N-Term)

Catalog No. ABIN635568

This anti-PCDH15 antibody is a Rabbit Polyclonal antibody detecting PCDH15 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for PCDH15 antibody (N-Term) (ABIN635568)

Target: PCDH15 (Protocadherin-15 (PCDH15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDH15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCDH15 Antibody

Binding Specificity: N-Term

Specificity: PCDH15 antibody was raised against the N terminal of PCDH15

Purification: Affinity purified

Immunogen: PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDH15 Blocking Peptide, (ABIN939239), is also available for use as a blocking control in assays to test for specificity of this PCDH15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDH15

Target: PCDH15 (Protocadherin-15 (PCDH15))

Alternative Name: PCDH15

Background: PCDH15 is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. PCDH15 consists of a signal peptide, 11 extracellular calcium-binding domains, a transmembrane domain and a unique cytoplasmic domain. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene have been associated with hearing loss, which is consistent with its location at the Usher syndrome type 1F (USH1F) critical region on chromosome 10.

Molecular Weight: 80 kDa (MW of target protein)

Pathways: Sensory Perception of Sound