ANO1 antibody (Middle Region)
-
- Target See all ANO1 Antibodies
- ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ANO1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM16 A antibody was raised against the middle region of TMEM16
- Purification
- Affinity purified
- Immunogen
- TMEM16 A antibody was raised using the middle region of TMEM16 corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY
- Top Product
- Discover our top product ANO1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM16A Blocking Peptide, catalog no. 33R-3735, is also available for use as a blocking control in assays to test for specificity of this TMEM16A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))
- Alternative Name
- TMEM16A (ANO1 Products)
- Synonyms
- DOG1 antibody, ORAOV2 antibody, TAOS2 antibody, TMEM16A antibody, Tmem16a antibody, anoctamin 1 antibody, anoctamin 1, calcium activated chloride channel antibody, Ano1 antibody, ANO1 antibody
- Background
- TMEM16A belongs to the anoctamin family. TMEM16A acts as a calcium-activated chloride channel. It is required for normal tracheal development.
- Molecular Weight
- 111 kDa (MW of target protein)
-