FAM200A antibody (Middle Region)

Catalog No. ABIN635578

Product Details anti-FAM200A Antibody

Target: FAM200A (C7orf38) (Chromosome 7 Open Reading Frame 38 (C7orf38))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM200A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C7 ORF38 antibody was raised against the middle region of C7 rf38

Purification: Affinity purified

Immunogen: C7 ORF38 antibody was raised using the middle region of C7 rf38 corresponding to a region with amino acids QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C7ORF38 Blocking Peptide, catalog no. 33R-7749, is also available for use as a blocking control in assays to test for specificity of this C7ORF38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM200A

Target: FAM200A (C7orf38) (Chromosome 7 Open Reading Frame 38 (C7orf38))

Alternative Name: C7ORF38 (C7orf38 Products)

Synonyms: C7orf38 antibody, family with sequence similarity 200 member A antibody, FAM200A antibody

Background: The function of C7ORF38 protein has not been widely studied, and is yet to be fully elucidated. The protein is weakly similar to transposase-like proteins in human and mouse.

Molecular Weight: 66 kDa (MW of target protein)