CYP4A22 antibody (N-Term)
-
- Target See all CYP4A22 Antibodies
- CYP4A22 (Cytochrome P450, Family 4, Subfamily A, Polypeptide 22 (CYP4A22))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP4A22 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP4 A22 antibody was raised against the N terminal of CYP4 22
- Purification
- Affinity purified
- Immunogen
- CYP4 A22 antibody was raised using the N terminal of CYP4 22 corresponding to a region with amino acids AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS
- Top Product
- Discover our top product CYP4A22 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP4A22 Blocking Peptide, catalog no. 33R-1452, is also available for use as a blocking control in assays to test for specificity of this CYP4A22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP4A22 (Cytochrome P450, Family 4, Subfamily A, Polypeptide 22 (CYP4A22))
- Alternative Name
- CYP4A22 (CYP4A22 Products)
- Synonyms
- cytochrome P450 family 4 subfamily A member 22 antibody, cytochrome P450, family 4, subfamily A, polypeptide 22 antibody, CYP4A22 antibody
- Background
- CYP4A22 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha, Monocarboxylic Acid Catabolic Process
-